Cat.No. | ra-3031A |
Availability | |
Size | 100µg500ug1mg |
Price | $ |
Qty |
Protein Name: | Bla g 1 |
Source: | E.coli |
Species: | Blattella germanica (German cockroach) |
Description: | Recombinant Bla g 1 was expressed in E.coli with His tag. |
MW: | 46 kDa |
Tag: | His |
Formulation: | 50 mM Tris-HCl, 300 mM NaCl (pH 7.5) |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 0.5-1.0mg/mL |
GenBank Protein: | AAD13530 |
UniProt: | Q9UAM5 |
Sequence: | NLLEKLREKGVDVDKIIELIRALFGLTLNAKASRNLQDDLQDFLALIPVDQIIAIATDYL ANDAEVQAAVAYLQSDEFETIVVALDALPELQNFLNFLEANGLNAIDFLNGIHDLLGIPH IPVSGRKYHIRRGVGITGLIDDVLAILPIEDLKALFNEKLETSPDFLALYNAIRSPEFQS IVQTLNAMPEYQNLLQKLREKGVDVDKIIELIRALFGLTLNGKASRNLQDDLQDFLALIP VDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQNFLNFLEANGLNAIDF LNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDLKALFNEKLETSPDFLA LYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELIRALFGLTH |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3031AB | Recombinant Bla g 1, Biotin Labeled | Inquiry |
ra-3033A | Recombinant Bla g 3 | Inquiry |
ra-3034AY | Recombinant Bla g 4 | Inquiry |
ra-3035AB | Recombinant Bla g 5, Biotin Labeled | Inquiry |
ra-3034AB | Recombinant Bla g 4, Biotin Labeled | Inquiry |
ra-3034AYB | Recombinant Bla g 4, Biotin Labeled | Inquiry |
ra-3037AB | Recombinant Bla g 7, Biotin Labeled | Inquiry |
ra-3032AB | Recombinant Bla g 2, Biotin Labeled | Inquiry |
ra-3041A | Recombinant Bla g 12 | Inquiry |
ra-3040A | Recombinant Bla g 11 | Inquiry |
ra-3039A | Recombinant Bla g 9 | Inquiry |
ra-3038A | Recombinant Bla g 8 | Inquiry |
ra-3037A | Recombinant Bla g 7 | Inquiry |
ra-3036A | Recombinant Bla g 6 | Inquiry |
ra-3035A | Recombinant Bla g 5 | Inquiry |
ra-3034A | Recombinant Bla g 4 | Inquiry |
ra-3032A | Recombinant Bla g 2 | Inquiry |
ra-3201A | Recombinant Per a 1 | Inquiry |
ra-3202A | Recombinant Per a 2 | Inquiry |
ra-3203A | Recombinant Per a 3 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools