| Cat.No. | RA-3035AB |
| Availability |
| Protein Name: | Bla g 5 |
| Source: | E.coli |
| Species: | German cockroach |
| Description: | Recombinant biotinylation Bla g 5 was expressed in E.coli with N-terminal His tag. |
| MW: | 25 kDa |
| Tag: | His |
| Formulation: | Liquid in 50 mM Tris, 300 mM NaCl,pH 9.0 |
| Purity: | >90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 0.63mg/mL |
| GenBank Protein: | AAB72147 |
| UniProt: | O18598 |
| Sequence: | MGSSHHHHHHSSGLVPRGSHMYKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPKLKPSMPFGKTPVLEIDGKQTHQSVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKKETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALREKVLGLPAIKAWVAKRPPTDL |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3035A | Recombinant Bla g 5 Protein, N-His tagged | Inquiry |
| RA-3041A | Recombinant Bla g 12 | Inquiry |
| RA-3034AY | Recombinant Bla g 4 | Inquiry |
| RA-3037AB | Recombinant Bla g 7, Biotin Labeled | Inquiry |
| RA-3034AYB | Recombinant Bla g 4, Biotin Labeled | Inquiry |
| RA-3032AB | Recombinant Bla g 2, Biotin Labeled | Inquiry |
| RA-3031AB | Recombinant Bla g 1, Biotin Labeled | Inquiry |
| RA-3034AB | Recombinant Bla g 4, Biotin Labeled | Inquiry |
| RA-3031A | Recombinant Bla g 1 Protein, N-His tagged | Inquiry |
| RA-3040A | Recombinant Bla g 11 | Inquiry |
| RA-3039A | Recombinant Bla g 9 Protein, N-His tagged | Inquiry |
| RA-3038A | Recombinant Bla g 8 | Inquiry |
| RA-3037A | Recombinant Bla g 7 | Inquiry |
| RA-3036A | Recombinant Bla g 6 | Inquiry |
| RA-3034A | Recombinant Bla g 4 | Inquiry |
| RA-3033A | Recombinant Bla g 3 | Inquiry |
| RA-3032A | Recombinant Bla g 2 Protein, C-His tagged | Inquiry |
| RA-3201A | Recombinant Per a 1 | Inquiry |
| RA-3202A | Recombinant Per a 2 | Inquiry |
| RA-3203A | Recombinant Per a 3 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools