| Cat.No. | RA-3031A |
| Availability | |
| Size | 100µg500µg1mg |
| Price | $ |
| Qty |
| Source: | E.coli |
| ShortName: | Bla g 1, N-His tagged |
| similar: | Bla g 1 |
| Tag: | N-His |
| Product Overview: | Recombinant Bla g 1 Protein with N-His tag was expressed in E.coli. |
| Form: | Sterile 50mM Tris, 300mM NaCl, pH8.0 |
| Molecular Mass: | 48 kDa |
| AASequence: | MGSSHHHHHHSSGLVPRGSHMNLLEKLREKGVDVDKIIELIRALFGLTLNAKASRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVALDALPELQNFLNFLEANGLNAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPIEDLKALFNEKLETSPDFLALYNAIRSPEFQSIVQTLNAMPEYQNLLQKLREKGVDVDKIIELIRALFGLTLNGKASRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQNFLNFLEANGLNAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDLKALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELIRALFGLTH |
| Purity: | > 90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 centigRAde. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 1.1 mg/mL by BCA |
| Official Symbol: | Bla g 1 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Bla g 1 1. Bla g 1 2. BSA |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3031AB | Recombinant Bla g 1, Biotin Labeled | Inquiry |
| RA-3033A | Recombinant Bla g 3 | Inquiry |
| RA-3034AY | Recombinant Bla g 4 | Inquiry |
| RA-3035AB | Recombinant Bla g 5, Biotin Labeled | Inquiry |
| RA-3034AB | Recombinant Bla g 4, Biotin Labeled | Inquiry |
| RA-3034AYB | Recombinant Bla g 4, Biotin Labeled | Inquiry |
| RA-3037AB | Recombinant Bla g 7, Biotin Labeled | Inquiry |
| RA-3032AB | Recombinant Bla g 2, Biotin Labeled | Inquiry |
| RA-3041A | Recombinant Bla g 12 | Inquiry |
| RA-3040A | Recombinant Bla g 11 | Inquiry |
| RA-3039A | Recombinant Bla g 9 Protein, N-His tagged | Inquiry |
| RA-3038A | Recombinant Bla g 8 | Inquiry |
| RA-3037A | Recombinant Bla g 7 | Inquiry |
| RA-3036A | Recombinant Bla g 6 | Inquiry |
| RA-3035A | Recombinant Bla g 5 Protein, N-His tagged | Inquiry |
| RA-3034A | Recombinant Bla g 4 | Inquiry |
| RA-3032A | Recombinant Bla g 2 Protein, C-His tagged | Inquiry |
| RA-3201A | Recombinant Per a 1 | Inquiry |
| RA-3202A | Recombinant Per a 2 | Inquiry |
| RA-3203A | Recombinant Per a 3 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools