Cat.No. | ra-3900F |
Availability | |
Size | 500ug |
Price | $ |
Qty |
Protein Name: | Cla h 8 |
Source: | E.coli |
Species: | Cladosporium herbarum (Fungus of plants) |
MW: | 30.6 kDa |
Tag: | His |
Formulation: | 50mM Tris, 300mM NaCl, pH 8.0 |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 0.5-1.0mg/mL |
GenBank Protein: | AAO91801 |
UniProt: | P0C0Y5 |
Description: | Recombinant Cla h 8 was expressed in E.coli with His tag. |
Sequence: | MGSSHHHHHHSSGLVPRGSHMPGQQATKHESLLDQLSLKGKVVVVTGASGPKGMGIEAARGCAEMGAAVAITYASRAQGAEENVKELEKTYGIKAKAYKCQVDSYESCEKLVKDVVADFGQIDAFIANAGATADSGILDGSVEAWNHVVQVDLNGTFHCAKAVGHHFKERGTGSLVITASMSGHIANFPQEQTSYNVAKAGCIHMARSLANEWRDFARVNSISPGYIDTGLSDFVPKETQQLWHSMIPMGRDGLAKELKGAYVYFASDASTYTTGADLLIDGGYTTR |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3900FB | Recombinant Cla h 8, Biotin Labeled | Inquiry |
ra-3894F | Recombinant Cla c 9 | Inquiry |
ra-3895F | Recombinant Cla c 14 | Inquiry |
ra-3896F | Recombinant Cla h 2 | Inquiry |
ra-3897F | Recombinant Cla h 5 | Inquiry |
ra-3898F | Recombinant Cla h 6 | Inquiry |
ra-3899F | Recombinant Cla h 7 | Inquiry |
ra-3901F | Recombinant Cla h 10 | Inquiry |
ra-3902F | Recombinant Cla h 9 | Inquiry |
ra-3903F | Recombinant Cla h 12 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools