| Cat.No. | ra-3900F |
| Availability | |
| Size | 500µg |
| Price | $ |
| Qty |
| Source: | E.coli |
| ShortName: | Cla h 8, N-His tagged |
| similar: | Cla h 8 |
| Tag: | N-His |
| Product Overview: | Recombinant Cla h 8 Protein with N-His tag was expressed in E.coli. |
| Form: | 50mM Tris, 300mM NaCl, pH 8.0 |
| Molecular Mass: | 30.6 kDa |
| AASequence: | MGSSHHHHHHSSGLVPRGSHMPGQQATKHESLLDQLSLKGKVVVVTGASGPKGMGIEAARGCAEMGAAVAITYASRAQGAEENVKELEKTYGIKAKAYKCQVDSYESCEKLVKDVVADFGQIDAFIANAGATADSGILDGSVEAWNHVVQVDLNGTFHCAKAVGHHFKERGTGSLVITASMSGHIANFPQEQTSYNVAKAGCIHMARSLANEWRDFARVNSISPGYIDTGLSDFVPKETQQLWHSMIPMGRDGLAKELKGAYVYFASDASTYTTGADLLIDGGYTTR |
| Purity: | > 90% by SDS-PAGE |
| Storage: | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: | 0.4 mg/mL |
| Official Symbol: | Cla h 8 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 12% SDS-PAGE and WB analysis profiles of purified Cla h8 |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| ra-3900FB | Recombinant Cla h 8, Biotin Labeled | Inquiry |
| ra-3894F | Recombinant Cla c 9 | Inquiry |
| ra-3895F | Recombinant Cla c 14 | Inquiry |
| ra-3896F | Recombinant Cla h 2 | Inquiry |
| ra-3897F | Recombinant Cla h 5 | Inquiry |
| ra-3898F | Recombinant Cla h 6 | Inquiry |
| ra-3899F | Recombinant Cla h 7 | Inquiry |
| ra-3901F | Recombinant Cla h 10 | Inquiry |
| ra-3902F | Recombinant Cla h 9 | Inquiry |
| ra-3903F | Recombinant Cla h 12 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools