Home > Products > Animal Allergens > Mite > Recombinant Der p 7, Biotin Labeled

Recombinant Der p 7, Biotin Labeled

Product Datasheets MSDS

Cat.No.	ra-3128AB
Availability

Inquiry Bulk Order Online Order

Specification
Related Products

Protein Name:	Der p 7
Source:	E.coli
Species:	European house dust mite
MW:	22kDa
Tag:	His
Formulation:	Liquid in 50 mM Tris, 300 mM NaCl, pH7.5
Purity:	>90% by SDS-PAGE
Storage:	Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration:	0.51mg/mL
GenBank Protein:	AAA80264
UniProt:	P49273
Product Discription:	Recombinant biotinylation Der p 7 was expressed in E.coli with C-terminal his tag.
Sequence:	DPIHYDKITEEINKAVDEAVAAIEKSETFDPMKVPDHSDKFERHIGIIDLKGELDMRNIQVRGLKQMKRVGDANVKSEDGVVKAHLLVGVHDDVVSMEYDLAYKLGDLHPNTHVISDIQDFVVELSLEVSEEGNMTLTSFEVRQFANVVNHIGGLSILDPIFAVLSDVLTAIFQDTVRAEMTKVLAPAFKKELERNNQ

Catalog#	Product Name	Inquiry
ra-3128A	Recombinant Der p 7	Inquiry
ra-3100A	Recombinant Der f 18	Inquiry
ra-3087A	Recombinant Der f 5	Inquiry
ra-3086A	Recombinant Der f 4	Inquiry
ra-3085A	Recombinant Der f 3	Inquiry
ra-3084A	Recombinant Der f 2	Inquiry
ra-3083A	Recombinant Der f 1	Inquiry
ra-3089A	Recombinant Der f 6	Inquiry
ra-3091A	Recombinant Der f 7	Inquiry
ra-3099A	Recombinant Der f 17	Inquiry
ra-3103A	Recombinant Der f 22	Inquiry
ra-3094A	Recombinant Der f 13	Inquiry
ra-3092A	Recombinant Der f 10	Inquiry
ra-3096A	Recombinant Der f 14	Inquiry
ra-3098A	Recombinant Der f 16	Inquiry
ra-3093A	Recombinant Der f 11	Inquiry
ra-3102A	Recombinant Der f 21	Inquiry
ra-3104A	Recombinant Der f 23	Inquiry
ra-3095A	Recombinant Der f 8	Inquiry
ra-3083AM	Recombinant Der f 1	Inquiry

For research or industrial raw materials, not for personal medical use!

Contact Us

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0

Inquiry Basket

Copyright © Creative BioMart. All Rights Reserved.