Cat.No. | ra-3128A |
Availability |
Protein Name: | Der p 7 |
Product Description: | Recombinant Der p 7 was expressed in E.coli with C-terminal his tag. |
Source: | E.coli |
Species: | European house dust mite |
MW: | 22kDa |
Tag: | His |
Formulation: | Liquid in 50 mM Tris, 300 mM NaCl, pH7.5 |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 0.51mg/mL |
GenBank Protein: | AAA80264 |
UniProt: | P49273 |
Sequence: | DPIHYDKITEEINKAVDEAVAAIEKSETFDPMKVPDHSDKFERHIGIIDLKGELDMRNIQVRGLKQMKRVGDANVKSEDGVVKAHLLVGVHDDVVSMEYDLAYKLGDLHPNTHVISDIQDFVVELSLEVSEEGNMTLTSFEVRQFANVVNHIGGLSILDPIFAVLSDVLTAIFQDTVRAEMTKVLAPAFKKELERNNQ |
![]() |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3128AB | Recombinant Der p 7, Biotin Labeled | Inquiry |
ra-3100A | Recombinant Der f 18 | Inquiry |
ra-3087A | Recombinant Der f 5 | Inquiry |
ra-3086A | Recombinant Der f 4 | Inquiry |
ra-3085A | Recombinant Der f 3 | Inquiry |
ra-3084A | Recombinant Der f 2 | Inquiry |
ra-3083A | Recombinant Der f 1 | Inquiry |
ra-3089A | Recombinant Der f 6 | Inquiry |
ra-3091A | Recombinant Der f 7 | Inquiry |
ra-3099A | Recombinant Der f 17 | Inquiry |
ra-3103A | Recombinant Der f 22 | Inquiry |
ra-3094A | Recombinant Der f 13 | Inquiry |
ra-3092A | Recombinant Der f 10 | Inquiry |
ra-3096A | Recombinant Der f 14 | Inquiry |
ra-3098A | Recombinant Der f 16 | Inquiry |
ra-3093A | Recombinant Der f 11 | Inquiry |
ra-3102A | Recombinant Der f 21 | Inquiry |
ra-3104A | Recombinant Der f 23 | Inquiry |
ra-3095A | Recombinant Der f 8 | Inquiry |
ra-3083AM | Recombinant Der f 1 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools