Cat.No. | ra-3336AB |
Availability |
Protein Name: | Fel d 1 |
Source: | E.coli |
Species: | Cat |
Description: | Fel d 1 has two polypeptide chains,CH1 and CH2. Recombinant biotinylation Fel d 1 (fusioned of CH1-CH2) was expressed in E.coli with N-terminal His tag. |
MW: | 20.3 kDa |
Tag: | His |
Formulation: | Liquid in PBS Buffer, pH 7.4 |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 0.5mg/mL |
GenBank Protein: | AAC37318 (chain 1) AAC41616 (chain 2) |
UniProt: | P30438 (chain 1) P30440 (chain 2) |
Sequence: | MGSSHHHHHHSSGLVPRGSHMVKMAETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMKKIQDCYVENGLISRVLDGLVMTTISSSKDCMGEAVQNTVEDLKLNTLGREICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSVLDKIYTSPLC |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3336A | Recombinant Fel d 1 | Inquiry |
ra-3336AP | Recombinant Fel d 1 | Inquiry |
ra-3336APB | Recombinant Fel d 1, Biotin Labeled | Inquiry |
ra-3337A | Recombinant Fel d 2 | Inquiry |
ra-3338A | Recombinant Fel d 3 | Inquiry |
ra-3339A | Recombinant Fel d 4 | Inquiry |
ra-3340A | Recombinant Fel d 5 | Inquiry |
ra-3341A | Recombinant Fel d 6 | Inquiry |
ra-3342A | Recombinant Fel d 7 | Inquiry |
ra-3343A | Recombinant Fel d 8 | Inquiry |
ra-3339AB | Recombinant Fel d 4, Biotin Labeled | Inquiry |
ra-3343AB | Recombinant Fel d 8, Biotin Labeled | Inquiry |
ra-3342AB | Recombinant Fel d 7, Biotin Labeled | Inquiry |
ra-3338AB | Recombinant Fel d 3, Biotin Labeled | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools