Recombinant Fel d 1, Biotin Labeled

Protein Name:	Fel d 1
Source:	E.coli
Species:	Cat
MW:	20.3 kDa
Tag:	His
Formulation:	Liquid in PBS Buffer, pH 7.4
Purity:	>90% by SDS-PAGE
Storage:	Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration:	0.5mg/mL
GenBank Protein:	AAC37318 (chain 1) AAC41616 (chain 2)
UniProt:	P30438 (chain 1) P30440 (chain 2)
Product Discription:	Fel d 1 has two polypeptide chains,CH1 and CH2. Recombinant biotinylation Fel d 1 (fusioned of CH1-CH2) was expressed in E.coli with N-terminal His tag.
Sequence:	MGSSHHHHHHSSGLVPRGSHMVKMAETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMKKIQDCYVENGLISRVLDGLVMTTISSSKDCMGEAVQNTVEDLKLNTLGREICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSVLDKIYTSPLC

Catalog#	Product Name	Inquiry
ra-3336A	Recombinant Fel d 1	Inquiry
ra-3336AP	Recombinant Fel d 1	Inquiry
ra-3336APB	Recombinant Fel d 1, Biotin Labeled	Inquiry
ra-3337A	Recombinant Fel d 2	Inquiry
ra-3338A	Recombinant Fel d 3	Inquiry
ra-3339A	Recombinant Fel d 4	Inquiry
ra-3340A	Recombinant Fel d 5	Inquiry
ra-3341A	Recombinant Fel d 6	Inquiry
ra-3342A	Recombinant Fel d 7	Inquiry
ra-3343A	Recombinant Fel d 8	Inquiry
ra-3339AB	Recombinant Fel d 4, Biotin Labeled	Inquiry
ra-3343AB	Recombinant Fel d 8, Biotin Labeled	Inquiry
ra-3342AB	Recombinant Fel d 7, Biotin Labeled	Inquiry
ra-3338AB	Recombinant Fel d 3, Biotin Labeled	Inquiry

Cat.No.	ra-3336AB
Availability

Specification