| Cat.No. | RA-3336A |
| Availability | |
| Size | 100µg |
| Price | $ |
| Qty |
| Source: | E.coli |
| ShortName: | Fel d1, N-His tagged |
| similar: | Fel d1 |
| Tag: | N-His |
| Product Overview: | Recombinant Fel d1 Protein with N-His tag was expressed in E.coli. |
| Form: | Sterile PBS, pH 7.4 |
| Molecular Mass: | 20 kDa |
| AASequence: | MGSSHHHHHHSSGLVPRGSHMVKMAETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMKKIQDCYVENGLISRVLDGLVMTTISSSKDCMGEAVQNTVEDLKLNTLGREICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSVLDKIYTSPLC |
| Purity: | > 90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 centigRAde. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 0.53 mg/mL by BCA |
| Official Symbol: | Fel d1 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Fel d1 1. Fel d1 2. BSA |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3336AP | Recombinant Fel d 1 | Inquiry |
| RA-3336AB | Recombinant Fel d 1, Biotin Labeled | Inquiry |
| RA-3336APB | Recombinant Fel d 1, Biotin Labeled | Inquiry |
| RA-3337A | Recombinant Fel d 2 | Inquiry |
| RA-3338A | Recombinant Fel d 3 Protein, N-His tagged | Inquiry |
| RA-3339A | Recombinant Fel d 4 | Inquiry |
| RA-3340A | Recombinant Fel d 5 | Inquiry |
| RA-3341A | Recombinant Fel d 6 | Inquiry |
| RA-3342A | Recombinant Fel d 7 Protein, N-His tagged | Inquiry |
| RA-3343A | Recombinant Fel d 8 Protein, N-His tagged | Inquiry |
| RA-3339AB | Recombinant Fel d 4, Biotin Labeled | Inquiry |
| RA-3343AB | Recombinant Fel d 8, Biotin Labeled | Inquiry |
| RA-3342AB | Recombinant Fel d 7, Biotin Labeled | Inquiry |
| RA-3338AB | Recombinant Fel d 3, Biotin Labeled | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools