Filter By
Clear all Filters
Allergen Source
Allergen Species
Route of Allergen Exposure
Featured Products
Recombinant Fel d 3, Biotin Labeled
| Cat.No. |
ra-3338AB |
| Availability |
|
Inquiry
Bulk Order
Online Order
Specification
Related Products
| Protein Name: |
Fel d 3 |
| Source: |
E.coli |
| Species: |
Felis domesticus (F. catus) (Domestic cat) |
| MW: |
13 kDa |
| Tag: |
His |
| Formulation: |
50mM Tris, pH 8.0, 300mM NaCl |
| Purity: |
>90% by SDS-PAGE |
| Storage: |
Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: |
0.5-1.0mg/mL |
| GenBank Protein: |
AAL49391 |
| UniProt: |
Q8WNR9 |
| Product Discription: |
Recombinant biotinylation Fel d 3 was expressed in E.coli with His tag. |
| Sequence: |
MGSSHHHHHHSSGLVPRGSHMIPGGLSEAKPATPEIQEIANEVKPQLEEKTNETY
QKFEAIEYKTQVVAGINYYIKVQVDDNRYIHIKVFKGLPVQDSSLTLTGYQTGKSED
DELTGF |
For research or industrial raw materials, not for personal medical use!
