| Cat.No. | RA-3728P |
| Availability |
| Source: | E.coli |
| ShortName: | Ole e 1, N-His tagged |
| similar: | Ole e 1 |
| Tag: | N-His |
| Protein length: | 1-145 aa |
| Product Overview: | Recombinant Ole e 1 Protein with N-His tag was expressed in E.coli. |
| Form: | Sterile PBS, pH 7.4 |
| Molecular Mass: | 19 kDa |
| AASequence: | MGSSHHHHHHSSGLVPRGSHMEDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPLGFFKKEALPKCAQVYNKLGMYPPNM |
| Purity: | > 90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 centigRAde. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 0.33 mg/mL by BCA |
| Official Symbol: | Ole e 1 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Ole e 1 1. Ole e 1: 1 μg 2. BSA: 1 μg |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3728PB | Recombinant Ole e 1, Biotin Labeled | Inquiry |
| RA-3731P | Recombinant Ole e 4 | Inquiry |
| RA-3741P | Recombinant Ole e 14 | Inquiry |
| RA-3740P | Recombinant Ole e 13 | Inquiry |
| RA-3739P | Recombinant Ole e 12 | Inquiry |
| RA-3738P | Recombinant Ole e 11 | Inquiry |
| RA-3737P | Recombinant Ole e 10 | Inquiry |
| RA-3736P | Recombinant Ole e 9 | Inquiry |
| RA-3735P | Recombinant Ole e 8 | Inquiry |
| RA-3734P | Recombinant Ole e 7,partial | Inquiry |
| RA-3733P | Recombinant Ole e 6 | Inquiry |
| RA-3732P | Recombinant Ole e 5 | Inquiry |
| RA-3734PB | Recombinant Ole e 7,partial, Biotin Labeled | Inquiry |
| RA-3730P | Recombinant Ole e 3 | Inquiry |
| RA-3729P | Recombinant Ole e 2 | Inquiry |
| RA-3742P | Recombinant Ole e 15 | Inquiry |
| RA-3729PB | Recombinant Ole e 2, Biotin Labeled | Inquiry |
| RA-3732PB | Recombinant Ole e 5, Biotin Labeled | Inquiry |
| RA-3678P | Recombinant Hel a 2 | Inquiry |
| RA-3677P | Recombinant Hel a 1 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools