Recombinant Ole e 1 Protein, N-His tagged

Source:	E.coli
ShortName:	Ole e 1, N-His tagged
similar:	Ole e 1
Tag:	N-His
Protein length:	1-145 aa
Product Overview:	Recombinant Ole e 1 Protein with N-His tag was expressed in E.coli.
Form:	Sterile PBS, pH 7.4
Molecular Mass:	19 kDa
AASequence:	MGSSHHHHHHSSGLVPRGSHMEDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPLGFFKKEALPKCAQVYNKLGMYPPNM
Purity:	> 90% by SDS-PAGE
Storage:	Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration:	0.33 mg/mL by BCA
Official Symbol:	Ole e 1
	Figure Title 1: SDS-PAGE and WB Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Ole e 1 1. Ole e 1: 1 μg 2. BSA: 1 μg

Catalog#	Product Name	Inquiry
ra-3728PB	Recombinant Ole e 1, Biotin Labeled	Inquiry
ra-3731P	Recombinant Ole e 4	Inquiry
ra-3741P	Recombinant Ole e 14	Inquiry
ra-3740P	Recombinant Ole e 13	Inquiry
ra-3739P	Recombinant Ole e 12	Inquiry
ra-3738P	Recombinant Ole e 11	Inquiry
ra-3737P	Recombinant Ole e 10	Inquiry
ra-3736P	Recombinant Ole e 9	Inquiry
ra-3735P	Recombinant Ole e 8	Inquiry
ra-3734P	Recombinant Ole e 7,partial	Inquiry
ra-3733P	Recombinant Ole e 6	Inquiry
ra-3732P	Recombinant Ole e 5	Inquiry
ra-3734PB	Recombinant Ole e 7,partial, Biotin Labeled	Inquiry
ra-3730P	Recombinant Ole e 3	Inquiry
ra-3729P	Recombinant Ole e 2	Inquiry
ra-3742P	Recombinant Ole e 15	Inquiry
ra-3729PB	Recombinant Ole e 2, Biotin Labeled	Inquiry
ra-3732PB	Recombinant Ole e 5, Biotin Labeled	Inquiry
ra-3678P	Recombinant Hel a 2	Inquiry
ra-3677P	Recombinant Hel a 1	Inquiry

Cat.No.	ra-3728P
Availability

Specification