Filter By
Clear all Filters
Allergen Source
Allergen Species
Route of Allergen Exposure
Featured Products
Recombinant Pho d 2 Protein, C-His tagged
| Cat.No. |
RA-3461P |
| Availability |
|
Inquiry
Bulk Order
Online Order
Specification
Related Products
| Source: |
E.coli |
| ShortName: |
Pho d 2, C-His tagged |
| similar: |
Pho d 2 |
| Tag: |
C-His |
| Protein length: |
1-131 aa |
| Product Overview: |
Recombinant Pho d 2 Protein with C-His tag was expressed in E.coli. |
| Form: |
Sterile PBS, pH 7.4 |
| Molecular Mass: |
15 kDa |
| AASequence: |
MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVERLGDYLIEQGMHHHHHHHH |
| Endotoxin: |
< 1 EU/μg by LAL |
| Purity: |
> 90% by SDS-PAGE |
| StoRAge: |
Store it under sterile conditions at -20 to -80 centigRAde. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: |
1 mg/mL by BCA |
| Official Symbol: |
Pho d 2 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Pho d 2
1. Pho d 2: 1 μg
2. BSA: 1 μg
|
For research or industrial raw materials, not for personal medical use!
