Recombinant Sco s 1 Protein, C-His tagged

Source:	E.coli
ShortName:	Sco s 1, C-His tagged
similar:	Sco s 1
Tag:	C-His
Protein length:	1-109 aa
Product Overview:	Recombinant Sco s 1 Protein with C-His tag was expressed in E.coli.
Form:	Sterile PBS, pH 7.4
Molecular Mass:	13 kDa
AASequence:	MAFASVLKDAEITAALDGCKAAGSFDHKKFFKACGLSGKSADEVKKAFAIIDQDKSGYIEEEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGVDEFAAMIKGHHHHHHHH
Endotoxin:	< 1 EU/μg by LAL
Purity:	> 90% by SDS-PAGE
StoRAge:	Store it under sterile conditions at -20 to -80 centigRAde. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles.
ConcentRAtion:	1 mg/mL by BCA
Official Symbol:	Sco s 1
	Figure Title 1: SDS-PAGE and WB Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Sco s 1 1. Sco s 1: 1 μg 2. BSA: 1 μg

Catalog#	Product Name	Inquiry
RA-3240A	Recombinant Sco m 5	Inquiry
RA-3010A	Recombinant Aed a 11	Inquiry
RA-3123AMB	Recombinant Der p 2, Biotin Labeled	Inquiry
RA-3018A	Recombinant Api m 3	Inquiry
RA-3017A	Recombinant Api m 2	Inquiry
RA-3016A	Recombinant Api m 1	Inquiry
RA-3015A	Recombinant Api d 1	Inquiry
RA-3014A	Recombinant Api c 1	Inquiry
RA-3013A	Recombinant Ano d 2	Inquiry
RA-3012A	Recombinant Aed al 3	Inquiry
RA-3011A	Recombinant Aed al 2	Inquiry
RA-3000A	Recombinant Aca s 13 Protein, C-His tagged	Inquiry
RA-3009A	Recombinant Aed a 10	Inquiry
RA-3008A	Recombinant Aed a 8	Inquiry
RA-3007A	Recombinant Aed a 7	Inquiry
RA-3006A	Recombinant Aed a 6	Inquiry
RA-3005A	Recombinant Aed a 5	Inquiry
RA-3004A	Recombinant Aed a 4	Inquiry
RA-3003A	Recombinant Aed a 3	Inquiry
RA-3002A	Recombinant Aed a 2	Inquiry

Cat.No.	RA-3398A
Availability

Specification