| Cat.No. | ra-3404A |
| Availability |
| Source: | E.coli |
| ShortName: | Xip g 1, C-His tagged |
| similar: | Xip g 1 |
| Tag: | C-His |
| Protein length: | 1-109 aa |
| Product Overview: | Recombinant Xip g 1 Protein with C-His tag was expressed in E.coli. |
| Form: | Sterile 50mM Tris, 300mM NaCl, pH8.0 |
| Molecular Mass: | 13 kDa |
| AASequence: | MAFAGVLSDADVAAALEACKDAGTFDYKKFFKSCGLAAKSTDDVKKAFAIIDQDKSGFIEEDELKLFLQNFKAAARPLTDAETEAFLKAGDSDGDGKIGAEEFAALVTAHHHHHHHH |
| Endotoxin: | < 1 EU/μg by LAL |
| Purity: | > 90% by SDS-PAGE |
| Storage: | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: | 1 mg/mL by BCA |
| Official Symbol: | Xip g 1 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Xip g 1 1. Xip g 1: 1 μg 2. BSA: 1 μg |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| ra-3363A | Recombinant Lat c 1 | Inquiry |
| ra-3344AB | Recombinant Gad c 1, Biotin Labeled | Inquiry |
| ra-3377A | Recombinant Pan h 4 | Inquiry |
| ra-3376A | Recombinant Pan h 3 | Inquiry |
| ra-3375A | Recombinant Pan h 2 | Inquiry |
| ra-3374A | Recombinant Pan h 1 | Inquiry |
| ra-3370A | Recombinant Ore m 4 | Inquiry |
| ra-3369A | Recombinant Onc m 1 | Inquiry |
| ra-3368A | Recombinant Onc k 5 | Inquiry |
| ra-3365A | Recombinant Lep w 1 | Inquiry |
| ra-3364A | Recombinant Lat c 6 | Inquiry |
| ra-3028A | Recombinant Arc s 8 | Inquiry |
| ra-3347A | Recombinant Gad m 3 | Inquiry |
| ra-3346A | Recombinant Gad m 2 | Inquiry |
| ra-3345A | Recombinant Gad m 1 | Inquiry |
| ra-3344A | Recombinant Gad c 1 | Inquiry |
| ra-3328A | Recombinant Cyp c 2 | Inquiry |
| ra-3327A | Recombinant Cyp c 1 Protein, C-His tagged | Inquiry |
| ra-3326A | Recombinant Cten i 1 | Inquiry |
| ra-3323A | Recombinant Clu h 1 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools