Protein Name: | Bet v 2 |
Cat#: | ra-3596PB |
Product Name: | Recombinant Bet v 2, Biotin Labeled |
Source: | E.coli |
Species: | European white birch |
MW: | 15 kDa |
Tag: | His |
Formulation: | Liquid in 50 mM Tirs, 300 mM NaCl, 1 M urea, pH 8.0 |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 1.0mg/mL |
GenBank Protein: | AAA16522 |
UniProt: | P25816 |
Product Discription: | Recombinant biotinylation Bet v 2 was expressed in E.coli with His tag. |
Sequence: | MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGL |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3596P | Recombinant Bet v 2 | Inquiry |
ra-3599P | Recombinant Bet v 6 | Inquiry |
ra-3595PP | Recombinant Bet v 1 | Inquiry |
ra-3595PB | Recombinant Bet v 1, Biotin Labeled | Inquiry |
ra-3595PPB | Recombinant Bet v 1, Biotin Labeled | Inquiry |
ra-3601P | Recombinant Bet v 8 | Inquiry |
ra-3600P | Recombinant Bet v 7 | Inquiry |
ra-3597PB | Recombinant Bet v 3, Biotin Labeled | Inquiry |
ra-3598P | Recombinant Bet v 4 | Inquiry |
ra-3597P | Recombinant Bet v 3 | Inquiry |
ra-3595P | Recombinant Bet v 1 | Inquiry |
ra-3594P | Recombinant Beta v 2 | Inquiry |
ra-3593P | Recombinant Beta v 1 | Inquiry |
ra-3598PB | Recombinant Bet v 4, Biotin Labeled | Inquiry |
ra-3616P | Recombinant Car b 1 | Inquiry |
ra-3636P | Recombinant Cof a 1 | Inquiry |
ra-3764P1 | Recombinant Pla a 3.02 | Inquiry |
ra-3527P | Recombinant Aln g 4 | Inquiry |
ra-3664P | Recombinant Fag s 1 | Inquiry |
ra-3668P | Recombinant Fra e 1 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools