| Cat.No. | ra-3343A |
| Availability | |
| Size | 250ug |
| Price | $ |
| Qty |
| Protein Name: | Fel d 8 |
| Source: | E.coli |
| Species: | Felis domesticus (F. catus) (Domestic cat) |
| MW: | 26 kDa |
| Tag: | His |
| Formulation: | 50mM Tris, 0.3M NaCl, pH 8.5, 0.1% SKL |
| Purity: | >90% by SDS-PAGE |
| Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: | 0.5-1.0mg/mL |
| GenBank Protein: | ADM15668 |
| UniProt: | F6K0R4 |
| Description: | Recombinant Fel d 8 was expressed in E.coli with His tag. |
| Sequence: | MGSSHHHHHHSSGLVPRGSHMQEVLSRVSSHITDALTQGLLGMNFLPTLQTIDFQ GPLKDIFSLVLGHQLTNGEANFMVQMKDLRLFQVFIETSPDFKGIDLRMPLAFSIQI KFPALNPYIFHVRTDMKVQLYLEKDVDNRYQLTFGHCRIVPETVWIQSGNFITPMK NFIVENIERALGNVIIHNFGAKMCPFINSWLYNLNPQVTNQLISLLLQHGTYQATVEI PAK |
 |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| ra-3343AB | Recombinant Fel d 8, Biotin Labeled | Inquiry |
| ra-3336A | Recombinant Fel d 1 | Inquiry |
| ra-3337A | Recombinant Fel d 2 | Inquiry |
| ra-3338A | Recombinant Fel d 3 | Inquiry |
| ra-3339A | Recombinant Fel d 4 | Inquiry |
| ra-3340A | Recombinant Fel d 5 | Inquiry |
| ra-3341A | Recombinant Fel d 6 | Inquiry |
| ra-3342A | Recombinant Fel d 7 | Inquiry |
| ra-3336AP | Recombinant Fel d 1 | Inquiry |
| ra-3336AB | Recombinant Fel d 1, Biotin Labeled | Inquiry |
| ra-3336APB | Recombinant Fel d 1, Biotin Labeled | Inquiry |
| ra-3339AB | Recombinant Fel d 4, Biotin Labeled | Inquiry |
| ra-3342AB | Recombinant Fel d 7, Biotin Labeled | Inquiry |
| ra-3338AB | Recombinant Fel d 3, Biotin Labeled | Inquiry |
