| Cat.No. | ra-3343A |
| Availability | |
| Size | 250µg |
| Price | $ |
| Qty |
| Source: | E.coli |
| ShortName: | Fel d 8, N-His tagged |
| similar: | Fel d 8 |
| Tag: | N-His |
| Product Overview: | Recombinant Fel d 8 Protein with N-His tag was expressed in E.coli. |
| Form: | 50mM Tris, 0.3M NaCl, pH 8.5, 0.1% SKL |
| Molecular Mass: | 26 kDa |
| AASequence: | MGSSHHHHHHSSGLVPRGSHMQEVLSRVSSHITDALTQGLLGMNFLPTLQTIDFQGPLKDIFSLVLGHQLTNGEANFMVQMKDLRLFQVFIETSPDFKGIDLRMPLAFSIQIKFPALNPYIFHVRTDMKVQLYLEKDVDNRYQLTFGHCRIVPETVWIQSGNFITPMKNFIVENIERALGNVIIHNFGAKMCPFINSWLYNLNPQVTNQLISLLLQHGTYQATVEIPAK |
| Purity: | > 90% by SDS-PAGE |
| Storage: | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: | 0.352 mg/mL |
| Official Symbol: | Fel d 8 |
|
Figure Title 1: SDS-PAGE
Figure Note 1: Reducing 12% SDS-PAGE analysis profiles of purified Fel d 8 Lane 1: Fel d 8 Lane 2: BSA |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| ra-3343AB | Recombinant Fel d 8, Biotin Labeled | Inquiry |
| ra-3337A | Recombinant Fel d 2 | Inquiry |
| ra-3336AP | Recombinant Fel d 1 | Inquiry |
| ra-3336AB | Recombinant Fel d 1, Biotin Labeled | Inquiry |
| ra-3338AB | Recombinant Fel d 3, Biotin Labeled | Inquiry |
| ra-3336APB | Recombinant Fel d 1, Biotin Labeled | Inquiry |
| ra-3342AB | Recombinant Fel d 7, Biotin Labeled | Inquiry |
| ra-3339AB | Recombinant Fel d 4, Biotin Labeled | Inquiry |
| ra-3342A | Recombinant Fel d 7 Protein, N-His tagged | Inquiry |
| ra-3341A | Recombinant Fel d 6 | Inquiry |
| ra-3340A | Recombinant Fel d 5 | Inquiry |
| ra-3339A | Recombinant Fel d 4 | Inquiry |
| ra-3338A | Recombinant Fel d 3 Protein, N-His tagged | Inquiry |
| ra-3336A | Recombinant Fel d1 Protein, N-His tagged | Inquiry |
| ra-3406P | Recombinant Ana c 2 | Inquiry |
| ra-3405P | Recombinant Ana c 1 | Inquiry |
| ra-3440P | Recombinant Mus a 2 | Inquiry |
| ra-3441P | Recombinant Mus a 3 | Inquiry |
| ra-3442P | Recombinant Mus a 1 | Inquiry |
| ra-3443P | Recombinant Mus a 5 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools