Protein Name: | Lol p 5a |
Cat#: | ra-3437P-1B |
Product Name: | Recombinant Lol p 5a, Biotin Labeled |
Source: | E.coli |
Species: | Rye grass |
MW: | 31 kDa |
Tag: | His |
Formulation: | Liquid in 50mM Tris, 300mM NaCl,pH8.0 |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 1.0mg/mL |
UniProt: | Q40240 |
Product Discription: | Recombinant biotinylation Lol p 5a was expressed in E.coli with N-terminal His tag. |
Sequence: | MGSSHHHHHHSSGLVPRGSHMADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLLVVQSLISLLIYY |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3437P-1 | Recombinant Lol p 5a | Inquiry |
ra-3438P | Recombinant Lol p 11 | Inquiry |
ra-3437P | Recombinant Lol p 5 | Inquiry |
ra-3436P | Recombinant Lol p 4 | Inquiry |
ra-3435P | Recombinant Lol p 1 | Inquiry |
ra-3433P | Recombinant Lol p 2 | Inquiry |
ra-3439P | Recombinant Lol p 3 | Inquiry |
ra-3435PB | Recombinant Lol p 1, Biotin Labeled | Inquiry |
ra-3421P | Recombinant Dac g 2 | Inquiry |
ra-3424P | Recombinant Fes p 4 | Inquiry |
ra-3423P | Recombinant Dac g 4 | Inquiry |
ra-3422P | Recombinant Dac g 5 | Inquiry |
ra-3407P | Recombinant Ant o 1 | Inquiry |
ra-3419P | Recombinant Dac g 1 | Inquiry |
ra-3418P | Recombinant Cyn d 24 | Inquiry |
ra-3745PM | Recombinant Par j 2 | Inquiry |
ra-3416P | Recombinant Cyn d 22 | Inquiry |
ra-3415P | Recombinant Cyn d 15 | Inquiry |
ra-3414P | Recombinant Cyn d 12 | Inquiry |
ra-3413P | Recombinant Cyn d 7 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools