Filter By
Clear all Filters
Allergen Source
Allergen Species
Route of Allergen Exposure
Featured Products
Recombinant Phl p 1
| Cat.No. |
RA-3451P |
| Availability |
|
Inquiry
Bulk Order
Online Order
Specification
Related Products
| Protein Name: |
Phl p 1 |
| Source: |
Yeast |
| Species: |
Phleum pRAtense (Timothy) |
| Description: |
Recombinant Phl p 1 (24-362aa) was expressed in E.coli or Yeast with His tag. |
| MW: |
27 kDa |
| Tag: |
His |
| Formulation: |
50 mM Tris-HCl, 300 mM NaCl (pH 7.5) |
| Purity: |
>90% by SDS-PAGE |
| StoRAge: |
Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: |
0.5-1.0mg/mL |
| GenBank Protein: |
CAA81613 |
| UniProt: |
Q40967 |
| Sequence: |
IPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNT PIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGD EQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKE KGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK |
| Catalog# |
Product Name |
Inquiry |
| RA-3451PP |
Recombinant Phl p 1 |
Inquiry |
| RA-3451PE |
Recombinant Phl p 1 Protein, N-His tagged |
Inquiry |
| RA-3451PB |
Recombinant Phl p 1, Biotin Labeled |
Inquiry |
| RA-3451PPB |
Recombinant Phl p 1, Biotin Labeled |
Inquiry |
| RA-3451PEB |
Recombinant Phl p 1 Protein, Biotin Labeled |
Inquiry |
| RA-3452P |
Recombinant Phl p 2 |
Inquiry |
| RA-3456P |
Recombinant Phl p 6 |
Inquiry |
| RA-3453P |
Recombinant Phl p 3 Protein, N-His tagged |
Inquiry |
| RA-3454P |
Recombinant Phl p 4 Protein, N-His tagged |
Inquiry |
| RA-3458P |
Recombinant Phl p 11 |
Inquiry |
| RA-3460P |
Recombinant Phl p 13 |
Inquiry |
| RA-3455PM |
Recombinant Phl p 5 |
Inquiry |
| RA-3455P |
Recombinant Phl p 5 |
Inquiry |
| RA-3452PB |
Recombinant Phl p 2, Biotin Labeled |
Inquiry |
| RA-3457P |
Recombinant Phl p7 Protein, N-His tagged |
Inquiry |
| RA-3457PB |
Recombinant Phl p 7 Protein, Biotin Labeled |
Inquiry |
| RA-3459P |
Recombinant Phl p 12 Protein, C-His tagged |
Inquiry |
| RA-3456PB |
Recombinant Phl p 6, Biotin Labeled |
Inquiry |
| RA-3459PB |
Recombinant Phl p 12, Biotin Labeled |
Inquiry |
| RA-3422P |
Recombinant Dac g 5 |
Inquiry |
For research or industrial raw materials, not for personal medical use!