| Cat.No. | RA-3451PP |
| Availability |
| Protein Name: | Phl p 1 |
| Source: | Nicotiana benthamiana |
| Species: | Phleum pRAtense (Timothy) |
| Description: | Recombinant Phl p 1 was expressed in Nicotiana benthamiana with His tag by Agrobacterium-mediated tRAnsient. |
| MW: | 27 kDa |
| Tag: | His |
| Formulation: | Lyophilized from 50 mM HEPES pH7.5, 100 mM NaCl, 175 mM Trehalose DihydRAte. |
| Purity: | >90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| GenBank Protein: | CAA81613 |
| UniProt: | Q40967 |
| Sequence: | IPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNT PIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGD EQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKE KGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools