Recombinant Phl p 1

Protein Name:	Phl p 1
Source:	Nicotiana benthamiana
Species:	Phleum pratense (Timothy)
Description:	Recombinant Phl p 1 was expressed in Nicotiana benthamiana with His tag by Agrobacterium-mediated transient.
MW:	27 kDa
Tag:	His
Formulation:	Lyophilized from 50 mM HEPES pH7.5, 100 mM NaCl, 175 mM Trehalose Dihydrate.
Purity:	>90% by SDS-PAGE
Storage:	Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
GenBank Protein:	CAA81613
UniProt:	Q40967
Sequence:	IPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNT PIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGD EQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKE KGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK

Catalog#	Product Name	Inquiry
ra-3451PEB	Recombinant Phl p 1 Protein, Biotin Labeled	Inquiry
ra-3451P	Recombinant Phl p 1	Inquiry
ra-3451PE	Recombinant Phl p 1 Protein, N-His tagged	Inquiry
ra-3451PPB	Recombinant Phl p 1, Biotin Labeled	Inquiry
ra-3451PB	Recombinant Phl p 1, Biotin Labeled	Inquiry
ra-3457PB	Recombinant Phl p 7 Protein, Biotin Labeled	Inquiry
ra-3456P	Recombinant Phl p 6	Inquiry
ra-3452PB	Recombinant Phl p 2, Biotin Labeled	Inquiry
ra-3454P	Recombinant Phl p 4 Protein, N-His tagged	Inquiry
ra-3455P	Recombinant Phl p 5	Inquiry
ra-3455PM	Recombinant Phl p 5	Inquiry
ra-3458P	Recombinant Phl p 11	Inquiry
ra-3459P	Recombinant Phl p 12 Protein, C-His tagged	Inquiry
ra-3457P	Recombinant Phl p7 Protein, N-His tagged	Inquiry
ra-3453P	Recombinant Phl p 3 Protein, N-His tagged	Inquiry
ra-3456PB	Recombinant Phl p 6, Biotin Labeled	Inquiry
ra-3460P	Recombinant Phl p 13	Inquiry
ra-3452P	Recombinant Phl p 2	Inquiry
ra-3459PB	Recombinant Phl p 12, Biotin Labeled	Inquiry
ra-3745PM	Recombinant Par j 2	Inquiry

Cat.No.	ra-3451PP
Availability

Specification