Protein Name: | Phl p 1 |
Cat#: | ra-3451PP |
Product Name: | Recombinant Phl p 1 |
Source: | Nicotiana benthamiana |
Species: | Phleum pratense (Timothy) |
MW: | 27 kDa |
Tag: | His |
Formulation: | Lyophilized from 50 mM HEPES pH7.5, 100 mM NaCl, 175 mM Trehalose Dihydrate. |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
GenBank Protein: | CAA81613 |
UniProt: | Q40967 |
Product Discription: | Recombinant Phl p 1 was expressed in Nicotiana benthamiana with His tag by Agrobacterium-mediated transient. |
Sequence: | IPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNT PIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGD EQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKE KGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3451PEB | Recombinant Phl p 1, Biotin Labeled | Inquiry |
ra-3451P | Recombinant Phl p 1 | Inquiry |
ra-3451PE | Recombinant Phl p 1 | Inquiry |
ra-3451PPB | Recombinant Phl p 1, Biotin Labeled | Inquiry |
ra-3451PB | Recombinant Phl p 1, Biotin Labeled | Inquiry |
ra-3457PB | Recombinant Phl p 7, Biotin Labeled | Inquiry |
ra-3456P | Recombinant Phl p 6 | Inquiry |
ra-3452PB | Recombinant Phl p 2, Biotin Labeled | Inquiry |
ra-3454P | Recombinant Phl p 4 | Inquiry |
ra-3455P | Recombinant Phl p 5 | Inquiry |
ra-3455PM | Recombinant Phl p 5 | Inquiry |
ra-3458P | Recombinant Phl p 11 | Inquiry |
ra-3459P | Recombinant Phl p 12 | Inquiry |
ra-3457P | Recombinant Phl p 7 | Inquiry |
ra-3453P | Recombinant Phl p 3 | Inquiry |
ra-3456PB | Recombinant Phl p 6, Biotin Labeled | Inquiry |
ra-3460P | Recombinant Phl p 13 | Inquiry |
ra-3452P | Recombinant Phl p 2 | Inquiry |
ra-3459PB | Recombinant Phl p 12, Biotin Labeled | Inquiry |
ra-3745PM | Recombinant Par j 2 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools