| Cat.No. | RA-3457P |
| Availability | |
| Size | 300µg |
| Price | $ |
| Qty |
| Source: | E.coli |
| ShortName: | Phl p7, N-His tagged |
| similar: | Phl p7 |
| Tag: | N-His |
| Protein length: | 1-78 aa |
| Product Overview: | Recombinant Phl p7 Protein with N-His tag was expressed in E.coli. |
| Form: | Sterile 50mM Tris, 300mM NaCl, pH 7.5 |
| Molecular Mass: | 10 kDa |
| AASequence: | MHHHHHHHHMADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF |
| Purity: | > 90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 centigRAde. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 0.63 mg/mL by BCA |
| Official Symbol: | Phl p7 |
|
Figure Title 1: SDS-PAGE Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) analysis profile of purified Phl p7 1. Phl p7: 1 μg 2. BSA: 1 μg |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools