Recombinant Phl p 12 Protein, C-His tagged

Source:	E.coli
ShortName:	Phl p 12, C-His tagged
similar:	Phl p 12
Tag:	C-His
Protein length:	1-131 aa
Product Overview:	Recombinant Phl p 12 Protein with C-His tag was expressed in E.coli.
Form:	Sterile PBS, pH 7.4
Molecular Mass:	15 kDa
AASequence:	MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVEQGMHHHHHHHH
Purity:	> 90% by SDS-PAGE
Storage:	Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration:	0.26 mg/mL by BCA
Official Symbol:	Phl p 12
	Figure Title 1: SDS-PAGE and WB Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Phl p 12 1. Phl p 12: 1 μg 2. BSA: 1 μg

Catalog#	Product Name	Inquiry
ra-3459PB	Recombinant Phl p 12, Biotin Labeled	Inquiry
ra-3451P	Recombinant Phl p 1	Inquiry
ra-3455P	Recombinant Phl p 5	Inquiry
ra-3452P	Recombinant Phl p 2	Inquiry
ra-3451PP	Recombinant Phl p 1	Inquiry
ra-3451PE	Recombinant Phl p 1 Protein, N-His tagged	Inquiry
ra-3453P	Recombinant Phl p 3 Protein, N-His tagged	Inquiry
ra-3457P	Recombinant Phl p7 Protein, N-His tagged	Inquiry
ra-3460P	Recombinant Phl p 13	Inquiry
ra-3451PPB	Recombinant Phl p 1, Biotin Labeled	Inquiry
ra-3455PM	Recombinant Phl p 5	Inquiry
ra-3451PEB	Recombinant Phl p 1 Protein, Biotin Labeled	Inquiry
ra-3454P	Recombinant Phl p 4 Protein, N-His tagged	Inquiry
ra-3452PB	Recombinant Phl p 2, Biotin Labeled	Inquiry
ra-3451PB	Recombinant Phl p 1, Biotin Labeled	Inquiry
ra-3456P	Recombinant Phl p 6	Inquiry
ra-3457PB	Recombinant Phl p 7 Protein, Biotin Labeled	Inquiry
ra-3458P	Recombinant Phl p 11	Inquiry
ra-3456PB	Recombinant Phl p 6, Biotin Labeled	Inquiry
ra-3422P	Recombinant Dac g 5	Inquiry

Cat.No.	ra-3459P
Availability

Specification