| Cat.No. | RA-3451PE |
| Availability | |
| Size | 150µg |
| Price | $ |
| Qty |
| Source: | E.coli |
| ShortName: | Phl p 1, N-His tagged |
| similar: | Phl p 1 |
| Tag: | N-His |
| Protein length: | 24-263 aa |
| Product Overview: | Recombinant Phl p 1 Protein with N-His tag was expressed in E.coli. |
| Form: | Sterile PBS, pH 7.4 |
| Molecular Mass: | 27 kDa |
| AASequence: | MHHHHHHHHIPKVPPGPNITATYGDKWLDAKSTWYGKPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVIPEGWKADTAYESK |
| Purity: | > 90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 centigRAde. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 0.6 mg/mL by BCA |
| Official Symbol: | Phl p 1 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Phl p 1 1. Phl p 1: 1 μg 2. BSA: 1 μg |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools