Filter By
Clear all Filters
Allergen Source
Allergen Species
Route of Allergen Exposure
Featured Products
Recombinant Phl p 6
| Cat.No. |
ra-3456P |
| Availability |
|
Inquiry
Bulk Order
Online Order
Specification
Related Products
| Protein Name: |
Phl p 6 |
| Source: |
E.coli |
| Species: |
Phleum pratense (Timothy) |
| MW: |
11 kDa |
| Tag: |
His |
| Formulation: |
50 mM Tris-HCl, 300 mM NaCl (pH 7.5) |
| Purity: |
>90% by SDS-PAGE |
| Storage: |
Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: |
0.5-1.0mg/mL |
| GenBank Protein: |
CAA81608 |
| UniProt: |
P43215 |
| Sequence: |
GKATTEEQKLIEDVNASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADAVSKAPQLV
PKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALRIIAGTPEVHAVKPGA |
For research or industrial raw materials, not for personal medical use!
