Cat.No. | ra-3585PB |
Availability |
Protein Name: | Art v 1 |
Source: | E.coli |
Species: | Mugwort, wormwood |
MW: | 28 kDa |
Tag: | His |
Formulation: | Liquid in 50 mM Tris 300 mM NaCl PH8 |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 1.0mg/mL |
GenBank Protein: | AAO24900 |
UniProt: | Q84ZX5 |
Product Discription: | Recombinant biotinylation Art v 1 was expressed in E.coli with his tag. |
Sequence: | MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3585PM | Recombinant Art v 1 | Inquiry |
ra-3585P | Recombinant Art v 1 | Inquiry |
ra-3581P | Recombinant Art c 1 | Inquiry |
ra-3590P | Recombinant Art v 6 | Inquiry |
ra-3589P | Recombinant Art v 5 | Inquiry |
ra-3588P | Recombinant Art v 4 | Inquiry |
ra-3587P | Recombinant Art v 3 | Inquiry |
ra-3586P | Recombinant Art v 2 | Inquiry |
ra-3584P | Recombinant Art t 1 | Inquiry |
ra-3583P | Recombinant Art l 1 | Inquiry |
ra-3582P | Recombinant Art f 1 | Inquiry |
ra-3030A | Recombinant Art fr 5 | Inquiry |
ra-3580P | Recombinant Art ar 3 | Inquiry |
ra-3579P | Recombinant Art ar 2 | Inquiry |
ra-3578P | Recombinant Art ar 1 | Inquiry |
ra-3577P | Recombinant Art an 7 | Inquiry |
ra-3576P | Recombinant Art an 3 | Inquiry |
ra-3575P | Recombinant Art an 2 | Inquiry |
ra-3574P | Recombinant Art an 1 | Inquiry |
ra-3573P | Recombinant Art an 1 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools