Filter By
Clear all Filters
Allergen Source
Allergen Species
Route of Allergen Exposure
Featured Products
Recombinant Art v 1 Protein, His tagged
| Cat.No. |
ra-3585P |
| Availability |
|
Inquiry
Bulk Order
Online Order
Specification
Related Products
| Source: |
E.coli |
| ShortName: |
Art v 1, His tagged |
| similar: |
Art v 1 |
| Tag: |
His |
| Protein length: |
25-132 aa |
| Product Overview: |
Recombinant Art v 1 Protein with His tag was expressed in E.coli. |
| Form: |
Sterile 50mM Tris, 300mM NaCl, pH8.0 |
| Molecular Mass: |
29 kDa |
| AASequence: |
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH |
| Purity: |
> 90% by SDS-PAGE |
| Storage: |
Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: |
0.59 mg/mL by BCA |
| Official Symbol: |
Art v 1 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Art v 1
1. Art v 1: 1 μg
2. BSA: 1 μg
|
For research or industrial raw materials, not for personal medical use!
