| Cat.No. | RA-3585P |
| Availability |
| Source: | E.coli |
| ShortName: | Art v 1, His tagged |
| similar: | Art v 1 |
| Tag: | His |
| Protein length: | 25-132 aa |
| Product Overview: | Recombinant Art v 1 Protein with His tag was expressed in E.coli. |
| Form: | Sterile 50mM Tris, 300mM NaCl, pH8.0 |
| Molecular Mass: | 29 kDa |
| AASequence: | MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH |
| Purity: | > 90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 centigRAde. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 0.59 mg/mL by BCA |
| Official Symbol: | Art v 1 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Art v 1 1. Art v 1: 1 μg 2. BSA: 1 μg |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3585PB | Recombinant Art v 1, Biotin Labeled | Inquiry |
| RA-3585PM | Recombinant Art v 1 | Inquiry |
| RA-3581P | Recombinant Art c 1 | Inquiry |
| RA-3590P | Recombinant Art v 6 | Inquiry |
| RA-3589P | Recombinant Art v 5 | Inquiry |
| RA-3588P | Recombinant Art v 4 | Inquiry |
| RA-3587P | Recombinant Art v 3 | Inquiry |
| RA-3586P | Recombinant Art v 2 | Inquiry |
| RA-3584P | Recombinant Art t 1 | Inquiry |
| RA-3583P | Recombinant Art l 1 | Inquiry |
| RA-3582P | Recombinant Art f 1 | Inquiry |
| RA-3030A | Recombinant Art fr 5 | Inquiry |
| RA-3580P | Recombinant Art ar 3 | Inquiry |
| RA-3579P | Recombinant Art ar 2 | Inquiry |
| RA-3578P | Recombinant Art ar 1 | Inquiry |
| RA-3577P | Recombinant Art an 7 | Inquiry |
| RA-3576P | Recombinant Art an 3 | Inquiry |
| RA-3575P | Recombinant Art an 2 | Inquiry |
| RA-3574P | Recombinant Art an 1 | Inquiry |
| RA-3573P | Recombinant Art an 1 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools