| Cat.No. | ra-3587PB |
| Availability |
| Protein Name: | Art v 3 |
| Source: | E.coli |
| Species: | Mugwort, wormwood |
| Description: | Recombinant biotinylation Art v 3 was expressed in E.coli with N-terminal his tag. |
| MW: | 12 kDa |
| Tag: | His |
| Formulation: | Liquid in 50mM Hepes 300mM NaCl pH7.0 |
| Purity: | >90% by SDS-PAGE |
| Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: | 0.5mg/mL |
| UniProt: | P0C088 |
| Sequence: | MGSSHHHHHHSSGLVPRGSHMESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| ra-3587P | Recombinant Art v 3 | Inquiry |
| ra-3581P | Recombinant Art c 1 | Inquiry |
| ra-3585PM | Recombinant Art v 1 | Inquiry |
| ra-3590P | Recombinant Art v 6 | Inquiry |
| ra-3589P | Recombinant Art v 5 | Inquiry |
| ra-3588P | Recombinant Art v 4 | Inquiry |
| ra-3586P | Recombinant Art v 2 | Inquiry |
| ra-3585P | Recombinant Art v 1 Protein, His tagged | Inquiry |
| ra-3584P | Recombinant Art t 1 | Inquiry |
| ra-3583P | Recombinant Art l 1 | Inquiry |
| ra-3582P | Recombinant Art f 1 | Inquiry |
| ra-3030A | Recombinant Art fr 5 | Inquiry |
| ra-3580P | Recombinant Art ar 3 | Inquiry |
| ra-3579P | Recombinant Art ar 2 | Inquiry |
| ra-3578P | Recombinant Art ar 1 | Inquiry |
| ra-3577P | Recombinant Art an 7 | Inquiry |
| ra-3576P | Recombinant Art an 3 | Inquiry |
| ra-3575P | Recombinant Art an 2 | Inquiry |
| ra-3574P | Recombinant Art an 1 | Inquiry |
| ra-3573P | Recombinant Art an 1 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools