| Cat.No. | RA-3588P-1B |
| Availability |
| Protein Name: | Art v 4.01 |
| Source: | E.coli |
| Species: | Mugwort, wormwood |
| Description: | Recombinant biotinylation Art v 4.01 was expressed in E.coli with N-terminal His tag. |
| MW: | 16.4 kDa |
| Tag: | His |
| Formulation: | Liquid in 50mM Hepes pH7.0 300mM NaCl |
| Purity: | >90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 0.55mg/mL |
| GenBank Protein: | CAD12861 |
| UniProt: | Q8H2C9 |
| Sequence: | MGSSHHHHHHSSGLVPRGSHMSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAGQLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMVVERLGDYLLDQGM |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3588P-1 | Recombinant Art v 4.01 | Inquiry |
| RA-3581P | Recombinant Art c 1 | Inquiry |
| RA-3585PM | Recombinant Art v 1 | Inquiry |
| RA-3589P | Recombinant Art v 5 | Inquiry |
| RA-3588P | Recombinant Art v 4 | Inquiry |
| RA-3587P | Recombinant Art v 3 | Inquiry |
| RA-3586P | Recombinant Art v 2 | Inquiry |
| RA-3585P | Recombinant Art v 1 Protein, His tagged | Inquiry |
| RA-3584P | Recombinant Art t 1 | Inquiry |
| RA-3583P | Recombinant Art l 1 | Inquiry |
| RA-3582P | Recombinant Art f 1 | Inquiry |
| RA-3030A | Recombinant Art fr 5 | Inquiry |
| RA-3580P | Recombinant Art ar 3 | Inquiry |
| RA-3579P | Recombinant Art ar 2 | Inquiry |
| RA-3578P | Recombinant Art ar 1 | Inquiry |
| RA-3577P | Recombinant Art an 7 | Inquiry |
| RA-3576P | Recombinant Art an 3 | Inquiry |
| RA-3575P | Recombinant Art an 2 | Inquiry |
| RA-3574P | Recombinant Art an 1 | Inquiry |
| RA-3573P | Recombinant Art an 1 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools