Home > Products > Plant Allergens > Wormwood > Recombinant Art v 4.01, Biotin Labeled

Recombinant Art v 4.01, Biotin Labeled

Product Datasheets MSDS

Cat.No.	ra-3588P-1B
Availability

Inquiry Bulk Order Online Order

Specification
Related Products

Protein Name:	Art v 4.01
Source:	E.coli
Species:	Mugwort, wormwood
MW:	16.4 kDa
Tag:	His
Formulation:	Liquid in 50mM Hepes pH7.0 300mM NaCl
Purity:	>90% by SDS-PAGE
Storage:	Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration:	0.55mg/mL
GenBank Protein:	CAD12861
UniProt:	Q8H2C9
Product Discription:	Recombinant biotinylation Art v 4.01 was expressed in E.coli with N-terminal His tag.
Sequence:	MGSSHHHHHHSSGLVPRGSHMSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAGQLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMVVERLGDYLLDQGM

Catalog#	Product Name	Inquiry
ra-3588P-1	Recombinant Art v 4.01	Inquiry
ra-3581P	Recombinant Art c 1	Inquiry
ra-3585PM	Recombinant Art v 1	Inquiry
ra-3589P	Recombinant Art v 5	Inquiry
ra-3588P	Recombinant Art v 4	Inquiry
ra-3587P	Recombinant Art v 3	Inquiry
ra-3586P	Recombinant Art v 2	Inquiry
ra-3585P	Recombinant Art v 1	Inquiry
ra-3584P	Recombinant Art t 1	Inquiry
ra-3583P	Recombinant Art l 1	Inquiry
ra-3582P	Recombinant Art f 1	Inquiry
ra-3030A	Recombinant Art fr 5	Inquiry
ra-3580P	Recombinant Art ar 3	Inquiry
ra-3579P	Recombinant Art ar 2	Inquiry
ra-3578P	Recombinant Art ar 1	Inquiry
ra-3577P	Recombinant Art an 7	Inquiry
ra-3576P	Recombinant Art an 3	Inquiry
ra-3575P	Recombinant Art an 2	Inquiry
ra-3574P	Recombinant Art an 1	Inquiry
ra-3573P	Recombinant Art an 1	Inquiry

For research or industrial raw materials, not for personal medical use!

Contact Us

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

0

Inquiry Basket

Copyright © Creative BioMart. All Rights Reserved.