Filter By
Clear all Filters
Allergen Source
Allergen Species
Route of Allergen Exposure
Featured Products
Recombinant Art v 4.01, Biotin Labeled
Click Here to Submit an Inquiry
Online Order
Specification
Related Products
| Protein Name: |
Art v 4.01 |
| Cat#: |
ra-3588P-1B |
| Product Name: |
Recombinant Art v 4.01, Biotin Labeled |
| Source: |
E.coli |
| Species: |
Mugwort, wormwood |
| MW: |
16.4 kDa |
| Tag: |
His |
| Formulation: |
Liquid in 50mM Hepes pH7.0 300mM NaCl |
| Purity: |
>90% by SDS-PAGE |
| Storage: |
Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: |
0.55mg/mL |
| GenBank Protein: |
CAD12861 |
| UniProt: |
Q8H2C9 |
| Product Discription: |
Recombinant biotinylation Art v 4.01 was expressed in E.coli with N-terminal His tag. |
| Sequence: |
MGSSHHHHHHSSGLVPRGSHMSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAGQLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMVVERLGDYLLDQGM |
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
