Protein Name: | Art v 4.01 |
Cat#: | ra-3588P-1 |
Product Name: | Recombinant Art v 4.01 |
Product Description: | Recombinant Art v 4.01 was expressed in E.coli with N-terminal His tag. |
Source: | E.coli |
Species: | Mugwort, wormwood |
MW: | 16.4 kDa |
Tag: | His |
Formulation: | Liquid in 50mM Hepes pH7.0 300mM NaCl |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 0.55mg/mL |
GenBank Protein: | CAD12861 |
UniProt: | Q8H2C9 |
Sequence: | MGSSHHHHHHSSGLVPRGSHMSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAGQLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMVVERLGDYLLDQGM |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3588P-1B | Recombinant Art v 4.01, Biotin Labeled | Inquiry |
ra-3581P | Recombinant Art c 1 | Inquiry |
ra-3585PM | Recombinant Art v 1 | Inquiry |
ra-3589P | Recombinant Art v 5 | Inquiry |
ra-3588P | Recombinant Art v 4 | Inquiry |
ra-3587P | Recombinant Art v 3 | Inquiry |
ra-3586P | Recombinant Art v 2 | Inquiry |
ra-3585P | Recombinant Art v 1 | Inquiry |
ra-3584P | Recombinant Art t 1 | Inquiry |
ra-3583P | Recombinant Art l 1 | Inquiry |
ra-3582P | Recombinant Art f 1 | Inquiry |
ra-3030A | Recombinant Art fr 5 | Inquiry |
ra-3580P | Recombinant Art ar 3 | Inquiry |
ra-3579P | Recombinant Art ar 2 | Inquiry |
ra-3578P | Recombinant Art ar 1 | Inquiry |
ra-3577P | Recombinant Art an 7 | Inquiry |
ra-3576P | Recombinant Art an 3 | Inquiry |
ra-3575P | Recombinant Art an 2 | Inquiry |
ra-3574P | Recombinant Art an 1 | Inquiry |
ra-3573P | Recombinant Art an 1 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools